Expression of the urease operon increases the likelihood of bacterial survival by contibuting to acid resistance in vitro and in vivo in BALB/c mice. Y.enterocolitica enters the body via an oral path and must survive the acidic stomach before being able to colonize the intestinal mucosa (PubMed:7558281). Urease accessory protein ureG ureG MNSHSTDKRKKITRIGIGGPVGSGKTAIIEVITPILIKRGIKPLIITNDIVTTEDAKQVKRTLKGILDEEKILGVETGACPHTAVREDPSMNIAAVEEMEERFPDSNLIMIESGGDNLTLTFSPALADFYIYVIDVAEGEKIPRKNGPGLVQADILVINKIDLAPYVGASLDVMESDTKVVRGERPYILTNCKTGQGIEELVDMIMRDFLFTHVQPQGEHA Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by ureG (By similarity). UREG_YEREN 221